SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002221 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002221
Domain Number 1 Region: 422-709
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.81e-53
Family Eukaryotic proteases 0.0000275
Further Details:      
 
Domain Number 2 Region: 188-418
Classification Level Classification E-value
Superfamily vWA-like 3.08e-37
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 84-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000175
Family Complement control module/SCR domain 0.00039
Further Details:      
 
Domain Number 4 Region: 150-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000973
Family Complement control module/SCR domain 0.00048
Further Details:      
 
Domain Number 5 Region: 24-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000486
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002221   Gene: ENSGGOG00000002254   Transcript: ENSGGOT00000002269
Sequence length 716
Comment pep:novel chromosome:gorGor3.1:6:32825214:32848816:1 gene:ENSGGOG00000002254 transcript:ENSGGOT00000002269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLMVLFCLLFVYTGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
SRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRHCCPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGSRFGHGDKVRYRCSSN
LVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKES
LGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
KPKVLMSVLNDNSRDMTEVISSLENANYKGTEEFFILFVLGKSNMGGSPKTAVDRIREIL
NINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHMLDVS
KLTDTICGVGNMSANASDQERTPWHVTIKPKSQETCRGALISDQWVLTAAHCFRDGKDHS
LWRVNVGDPKSQWGKEFLIEKAVISPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTH
ARPICLPCTMEANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWT
SCAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGL
VSWGLYNPCLGSADKNSRKRAPRSKVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL
Download sequence
Identical sequences ENSGGOP00000002221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]