SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002228 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002228
Domain Number 1 Region: 1739-1984
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 1069-1210
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000228
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 390-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000268
Family EGF-type module 0.002
Further Details:      
 
Domain Number 4 Region: 530-659
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 5 Region: 774-891
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 6 Region: 467-509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000036
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 429-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000368
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 350-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000536
Family EGF-type module 0.00072
Further Details:      
 
Domain Number 9 Region: 196-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000166
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 118-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 11 Region: 884-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000145
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 12 Region: 1040-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000173
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 13 Region: 234-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 14 Region: 922-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1298-1334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000482
Family EGF-type module 0.016
Further Details:      
 
Domain Number 16 Region: 961-1001
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000712
Family EGF-type module 0.017
Further Details:      
 
Domain Number 17 Region: 1427-1460
Classification Level Classification E-value
Superfamily Notch domain 0.0000000785
Family Notch domain 0.0035
Further Details:      
 
Domain Number 18 Region: 1208-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000118
Family EGF-type module 0.01
Further Details:      
 
Domain Number 19 Region: 271-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000171
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 20 Region: 652-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 21 Region: 81-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000283
Family EGF-type module 0.017
Further Details:      
 
Domain Number 22 Region: 313-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.017
Further Details:      
 
Domain Number 23 Region: 695-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000357
Family EGF-type module 0.012
Further Details:      
 
Domain Number 24 Region: 2-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000438
Family EGF-type module 0.038
Further Details:      
 
Domain Number 25 Region: 158-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000695
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 26 Region: 1346-1377
Classification Level Classification E-value
Superfamily Notch domain 0.00000112
Family Notch domain 0.0015
Further Details:      
 
Domain Number 27 Region: 1386-1418
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 28 Region: 733-775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000213
Family EGF-type module 0.014
Further Details:      
 
Domain Number 29 Region: 1008-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000411
Family EGF-type module 0.04
Further Details:      
 
Domain Number 30 Region: 40-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002228
Domain Number - Region: 1251-1285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0429
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002228   Gene: ENSGGOG00000002258   Transcript: ENSGGOT00000002276
Sequence length 2281
Comment pep:known_by_projection chromosome:gorGor3.1:19:15446304:15485925:-1 gene:ENSGGOG00000002258 transcript:ENSGGOT00000002276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPCLDGSPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAG
TARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVD
ECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTY
DCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQL
QPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCAC
PMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGAN
PCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAG
FTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGA
KCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCE
SQVDECRSQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINR
YDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCA
HEPCSHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTC
PPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPC
GPHGICTNLAGSFSCTCHGGYTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFA
GPRCARDVDECLSNPCGPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCV
DGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTL
VDWCSRQPCQNGGRCVQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQ
CVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCE
DDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNG
TCVDLVGGFRCTCPPGYTGLRCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSG
PRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPV
GVPCQQTPRGPRCACPLGLSGSSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFR
CACAQGWTGPRCEAPAAAPEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCPVS
GGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFA
DGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILR
TSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHC
FPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPSVPLLPLLVAGAVLLLVILVL
GVMVARRKREHSTLWFPEGFSLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATD
WMDTECPEAKRLKVEEPGMGAEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGM
DVNVRGPDGFTPLMLASFCGGALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGE
TALHLAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLD
ARMADGSTALILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLK
NGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDI
VRLLDQPSGPRSPPGPHGLGPLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGR
GKKLTLACPGPLADSSVTLSPVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQL
GGPGRAGLGRQPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGT
PVSPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSP
PSLSDWSESTPSPATATGAMATSTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVL
A
Download sequence
Identical sequences ENSGGOP00000021817 ENSGGOP00000002228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]