SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002237 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002237
Domain Number 1 Region: 122-187
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.49e-19
Family AN1-like Zinc finger 0.0011
Further Details:      
 
Domain Number 2 Region: 5-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000485
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002237   Gene: ENSGGOG00000002274   Transcript: ENSGGOT00000002285
Sequence length 211
Comment pep:known_by_projection chromosome:gorGor3.1:6:38853078:39225359:1 gene:ENSGGOG00000002274 transcript:ENSGGOT00000002285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECAQGIWGSSKTMNLCSKCFADFQKKQPDDDSAPNTSNSQSDLFSEETTSDNNNTSITTP
TLSPSQQPLPTELNVTSPSKEECGPCTDTAHVSLITPTKRSCGTDSQSENEASPVKRPRL
LENTERSEETSRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDH
MGRGREEAIMKMVKLDRKVGRSCQRIGEGCS
Download sequence
Identical sequences ENSGGOP00000002237 ENSGGOP00000002237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]