SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002266 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002266
Domain Number 1 Region: 4-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000204
Family LASP-1 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002266
Domain Number - Region: 32-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0369
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002266   Gene: ENSGGOG00000002299   Transcript: ENSGGOT00000002316
Sequence length 1738
Comment pep:known_by_projection chromosome:gorGor3.1:10:127505514:127582461:-1 gene:ENSGGOG00000002299 transcript:ENSGGOT00000002316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVQPCSRCGYGVYPAEKISCIDQIWHKACFHCEVCKMMLSVNNFVSHQKKPYCHAHNPK
NNTFTSVYHTPLNLNVRTFPEAISGIRDQEDGEQFKSVFHWDMKSKDKEGAPNRQPLANE
RAYWTGYGEGNAWCPGALPDPEIVRMVEARKSLGEEYTEDYEQPRGKGSFPAMITPAYQR
AKKANQLASQVEYKRGHDERISRFSTVADTPELLRSKAGAQLQSDVRYTEDYEQQRGKGS
FPAMITPAYQIAKRANELASDVRYHQQYQKEMRGMAGPAIGAEGILTRECADQYGQGYPE
EYEEHRGKGSFPAMITPAYQNAKKAHELASDIKYRQDFNKMKGAAHYHSLPAQDNLVLKR
AQSVNKLVSEVEYKKDLESSRGHSINYCETPQFRNVSKISKFTSDNKYKENYQNHMRGRY
EGVGMDRRTLHAMKVGSLASNVAYKADYKHDIVDYNYPATLTPSYQTTMKLVPLKDANYR
QSIDKLKYSSVTDTPQIVQAKINAQQLSHVNYRADYEKNKLNYTLPQDVPQLVKAKTNAK
LFSEVKYKEGWEKTKGKGFEMKLDAMSLLAAKASGELASNVGLLLSLKIKYKEEYEKTKG
KAMGTADSRLLHSLQIAKMSSEVEYKKGFEESKTRFHLPMDMVNIRHAKKAQALASDLDY
RKKLHEYTVLPEDMKTQWAKKAYGLQSELQYKADLAWMKGVGWLTEGSLNLEQAKKAGQL
VSEKNYRQRVDELKFTSVTDSSQMEHAKKSQELQSGVAYKAGNEQSVHQYTISKDEPLFL
QARANAANLSEKLYKSSWENQKAKGFELRLDSLTFLAAKAKRDLASEVKYKEDYERSRGK
LIGAKDVQGDSQMSHSLQMSKLQSELEYKKGFEDTKSQCHVSLDMVHLVHARKAQHLATD
IGYKTAEHHFTALPTDMKVEWAKKAYGLQSDNQYRADVKWMKGTGWVATGSLNVEQAKKA
GELISEKKYRQHPDALKFTSIKDTPEMVQARISYTQAVDRLYREQGENIKHHYTLTADLP
EVLLAKLNAMNISETRYKESWSKLRDGGYKLRLDALPFQAAKASGEIISDYKYKEAFEKM
KGQMLGSRSLEDDISLAHSVYATSLQSDVNYKKGFEHSKAQFHLPLDMAALVHAKKAQTL
ASDQDYKHPLPQYTSLAEDLRLSCAKKAHKLQSENLYRSDLNFMRGVACVIPGTLEIEGR
KKASELISESKYRQHPHSFKYTAVTDTPNLLHAKFSNQITNERLYKAAGEDARHQYTMTL
GLPEFIRAKTNAANLSDAKYKESWRNLRAQGYKLTIEALPFQAARASGDIASDFLYRHDF
VKERGKLIGPQSVRDDPRIQHCRRMGQLQSELQYRRRATSSQAQFHLPMDMVHLVHAKNA
QALASDHDYRTQYHKFTALPEDLKMAWAKKAHALQSELRYKSDLIGMKGIGWLALRSPQI
ESAKKAGELISETKYRKKPDSIKFTTVVDSPDLVHAKNSYMHCNERMYRSGDAESLHRYT
LIPDHPDFTRARLNALHLSDKVYRNSWEQTRAGSYDFRLDAIPFQTARASREIASDFRYK
EAFLRDRGLQIGYRSVDDDPRMKHFLNVGRLQSDNEYKKDFAKSRSQFHSSTDQPGLLQA
KRSQQLASDVHYRQPLPQPTCDPEQLGLRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGS
YKVEMARRAAELANARGLGLQGAYRGAEAVEAGEHQSREVNPDATEILHVKRKKALLL
Download sequence
Identical sequences ENSGGOP00000002266 ENSGGOP00000002266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]