SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002278 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000002278
Domain Number - Region: 170-190
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0471
Family Delta-sleep-inducing peptide immunoreactive peptide 0.01
Further Details:      
 
Domain Number - Region: 72-147
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 0.0549
Family C-terminal domain of glutamyl-tRNA synthetase (GluRS) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002278   Gene: ENSGGOG00000002315   Transcript: ENSGGOT00000002328
Sequence length 385
Comment pep:known_by_projection chromosome:gorGor3.1:11:83155453:83193727:1 gene:ENSGGOG00000002315 transcript:ENSGGOT00000002328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNSRLKEEQIWHIRHLLKELSEEKAEGLPVVTREDVEEAMKEKWKFERDQEKNLRDMRMQ
ISNAEKLFLEKLSEKEYWEEYKNVGSERHAKLITSLQNDINTVKENAEKMSVFFKITLED
TRKKIIKETLLQLDQKKEWATQNAVKLIDKGSYLEIWENDWLKKEVAIHRKEVEELKNAI
HELEAENLVLIDQLFNCRLADLKIPRYPVLHSCPTSNPRHLLLLPLESCLISARRCWRLY
LTQAAGLEVPPEEMSLELPETHIEEKSELQPTEVESRDLMSSSDESTILHLSHENSIEDL
QYVKIDKEENSCTEFGDTDMKHLLYEDEKDFKDYVNLGPLGVKLMSVESKKMPIHFQEKE
IPVKLYKDVRSPESHITYKMTKSFL
Download sequence
Identical sequences ENSGGOP00000002278 ENSGGOP00000002278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]