SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002287 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002287
Domain Number 1 Region: 260-310
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000392
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Domain Number 2 Region: 193-228
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000234
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002287   Gene: ENSGGOG00000002324   Transcript: ENSGGOT00000002337
Sequence length 343
Comment pep:known_by_projection chromosome:gorGor3.1:X:117177859:117178890:-1 gene:ENSGGOG00000002324 transcript:ENSGGOT00000002337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKR
VTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVY
ELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRK
GPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGR
YGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCD
QQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT
Download sequence
Identical sequences G3QIS1 O15541
gi|5902158|ref|NP_008909.1| 9606.ENSP00000360497 ENSP00000360497 ENSP00000360497 ENSGGOP00000002287 NP_008909.1.87134 NP_008909.1.92137 XP_004064840.1.27298 5z56_M 5z58_M 6ff4_t ENSP00000360497 ENSGGOP00000002287 hsi002010306.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]