SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002296 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002296
Domain Number 1 Region: 137-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-78
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 84-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.64e-27
Family Nuclear receptor 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002296   Gene: ENSGGOG00000002331   Transcript: ENSGGOT00000002346
Sequence length 455
Comment pep:known_by_projection chromosome:gorGor3.1:3:25945026:26388358:1 gene:ENSGGOG00000002331 transcript:ENSGGOT00000002346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Download sequence
Identical sequences P10826
ENSP00000391391 ENSGGOP00000002296 NP_001277145.1.87134 NP_001277145.1.92137 XP_005545685.1.63531 XP_011751753.1.29376 XP_011811633.1.43180 XP_011830193.1.47321 XP_011899225.1.92194 XP_014987782.1.72884 XP_015300509.1.63531 XP_016796076.1.37143 XP_017748895.1.44346 XP_018879436.1.27298 ENSGGOP00000002296 IGBMC-1003-000 ENSP00000385865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]