SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002300 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002300
Domain Number 1 Region: 1579-1821
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-53
Family Ankyrin repeat 0.000000927
Further Details:      
 
Domain Number 2 Region: 343-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000612
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 514-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000172
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 4 Region: 551-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000561
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 5 Region: 589-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000653
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 475-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 7 Region: 768-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000181
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 8 Region: 277-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family EGF-type module 0.017
Further Details:      
 
Domain Number 9 Region: 928-1051
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000282
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 194-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000456
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 158-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 678-803
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000361
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 13 Region: 1047-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000566
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1253-1284
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 15 Region: 898-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000219
Family EGF-type module 0.019
Further Details:      
 
Domain Number 16 Region: 236-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000292
Family EGF-type module 0.025
Further Details:      
 
Domain Number 17 Region: 844-886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000511
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 809-849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000485
Family EGF-type module 0.018
Further Details:      
 
Domain Number 19 Region: 31-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000063
Family EGF-type module 0.024
Further Details:      
 
Domain Number 20 Region: 66-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000637
Family EGF-type module 0.013
Further Details:      
 
Domain Number 21 Region: 1216-1246
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 22 Region: 120-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000183
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002300
Domain Number - Region: 1089-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00273
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1175-1204
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1134-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00599
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 626-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0154
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 321-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002300   Gene: ENSGGOG00000002332   Transcript: ENSGGOT00000002350
Sequence length 2003
Comment pep:known_by_projection chromosome:gorGor3.1:6:33082834:33112112:-1 gene:ENSGGOG00000002332 transcript:ENSGGOT00000002350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLLLLLLCVSVVIPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE
KCQFPDPCQNAQLCQNGGSCQALLPTPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLED
PCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
HCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGREGPRCELRAGPCPP
RGCSNGGTCQLMPGKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTC
LCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVVTNECASAPCLNHADCHDLLNGFQCICL
PGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPA
GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAP
PEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGG
TCVNRPGTFSCLCAMGFQGPRCEGKIRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGS
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSL
CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGY
DGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFE
GPTCSHRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPC
LYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLS
LTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQMQPLGKETDSLSAG
FVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRQPRTQSAPHRR
RPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGA
LPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTASVSVPPHGGGALPR
CRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPPPRGRRFSAGM
RGPRPNPAIMRGRYGAAAGRGGRVSTDDWPCDWVALEACGSASNIPIPPPCLTPSPERGS
PQLDCGPPALQEMPINQGGEGKK
Download sequence
Identical sequences G3QIT2
XP_004043783.1.27298 ENSGGOP00000002300 ENSGGOP00000002300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]