SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002306 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002306
Domain Number 1 Region: 132-209
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000269
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002306   Gene: ENSGGOG00000002345   Transcript: ENSGGOT00000002356
Sequence length 220
Comment pep:known_by_projection chromosome:gorGor3.1:19:14365285:14366230:-1 gene:ENSGGOG00000002345 transcript:ENSGGOT00000002356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGGEERVLEKEEEDDDDEDEDDEDDVSEGSEVPESDRPAGAQHHQLNGERGPQSAKERVK
EWTPCGPHQGQDEGRGPAPGSGTRQVFSMAAMNKEGGTASVATGPDSPSPVPLPPGKPAL
PGADGTPFGCPPGRKEKPSDPVEWTVMDVVEYFTEAGFPEQATAFQEQEIDGKSLLLMQR
TDVLTGLSIRLGPALKIYEHHIKVLQQGHFEDDDPDGFLG
Download sequence
Identical sequences ENSGGOP00000002306 ENSGGOP00000002306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]