SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002308 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002308
Domain Number 1 Region: 53-322
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.11e-30
Family G proteins 0.023
Further Details:      
 
Domain Number 2 Region: 447-536
Classification Level Classification E-value
Superfamily EF-hand 7.88e-23
Family Eps15 homology domain (EH domain) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002308   Gene: ENSGGOG00000002346   Transcript: ENSGGOT00000002358
Sequence length 543
Comment pep:known_by_projection chromosome:gorGor3.1:19:44963864:44995620:1 gene:ENSGGOG00000002346 transcript:ENSGGOT00000002358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPALEDADFDGKPM
VLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDK
PFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAE
RVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWAL
GKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKR
ARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQ
ELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTEVGVQGGAFEGTHMG
PFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTK
LPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKG
SAE
Download sequence
Identical sequences A0A024R0S6 G3S6K4 Q9NZN4
ENSP00000263277 gi|21361462|ref|NP_055416.2| ENSP00000263277 ENSP00000263277 NP_055416.2.87134 NP_055416.2.92137 XP_004061114.1.27298 ENSGGOP00000002308 ENSGGOP00000002308 ENSGGOP00000023711 9606.ENSP00000263277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]