SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002310 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002310
Domain Number 1 Region: 690-870
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-38
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 280-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.06e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 496-686
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-34
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 4 Region: 86-260
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 903-1043,1072-1114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-29
Family Laminin G-like module 0.000000908
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002310
Domain Number - Region: 9-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00537
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002310   Gene: ENSGGOG00000003597   Transcript: ENSGGOT00000002360
Sequence length 1510
Comment pep:known_by_projection chromosome:gorGor3.1:11:61429337:61541580:-1 gene:ENSGGOG00000003597 transcript:ENSGGOT00000002360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLCSPAGIPPCSSGGLCTVLAPGEVGCDCSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGS
LLFSEGGAGRGGAGDVYQPTKGKEEFVATFKGNEFFCYDLSHNPIQSSTDEITLAFRTLQ
RNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEALVEPVNGKFNDNAWHDVRVTRNL
RQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSP
VSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCEDVAALDPVTFESPEA
FVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGGGAGSHSSAQRADYFAMELLDGH
LYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLATGDSEILDL
ESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRSLAEAQGAVGV
APFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTGFLGRVCEREATVLSYDGSMYMK
IMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQMKLTVNLDCLRVG
CAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHTRLEFHNIET
GIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELNARFGLRAIVADPVTF
KSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLG
NGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIG
GLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIGQVERGCDGPSTTCTE
ESCANQGVCLQQWDGFTCDCTMTSYGGPICNDPGTTYIFGKGGALITYTWPPNDRPSTRM
DRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSD
GKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVVDEWLLDK
GRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVGE
GPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDLLVASAE
CPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRSPFVPPPPTFYPFLTGVGATQDT
LPPPAARRPPSGGPCQAERDDSDCEEPIEASGFASGEVFDSSLPPTDDEDFYTTFPLVTD
RTTLLSPRKPAPRPNLRTDGATGAPGVLFAPSAPAPNLPAGKMNHRDPLQPLLENPPLGP
GAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGERGPPGAVEVIRESSSTTGMVVGI
VAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQSNGAVVKEKAPAAPKTPSKA
KKNKDKEYYV
Download sequence
Identical sequences ENSGGOP00000002310 ENSGGOP00000002310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]