SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002321 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002321
Domain Number 1 Region: 50-365
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.66e-98
Family Glycosyl hydrolases family 35 catalytic domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 483-619
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.53e-27
Family Beta-galactosidase LacA, domains 4 and 5 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002321   Gene: ENSGGOG00000002357   Transcript: ENSGGOT00000002371
Sequence length 635
Comment pep:known_by_projection chromosome:gorGor3.1:11:132698926:132744549:1 gene:ENSGGOG00000002357 transcript:ENSGGOT00000002371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTWSLRRRPGRTLGLLLLVALGFLVLRRLDWSTLVPLRLRHRQLGLQAKGWNFMLEDSTF
WIFGGSIHYFRVPREYWRDRLLKMKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFV
LMAAEIGLWVILRPGPYICSEMDLGGLPSWLLQDPGMRLRTTYKGFTEAVDLYFDHLMSR
VVPLQYKRGGPIIAVQVENEYGSYNKDPAYMPYVKKALEDRGIVELLLTSDNKDGLSKGI
VQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWTGWFDSWGGPHNILDSSEVLKT
VSAIVDAGSSINLYMFHGGTNFGFMNGAMHFHDYKSDVTSYDYDAVLTEAGDYTAKYMKL
RDFFGSISGIPLPPPPDLLPKMPYEPVTPVLYLSLWDALKYLGEPIKSEKPINMENLPVN
GGNGQSFGYILYETSITSSGILSGHVHDRGQVFVNTVSIGFLDYKTTKIAVPLIQGYTVL
RILVENRGRVNYGENIDDQRKGLIGNLYLNDSPLKKFRIYSLDMKKSFFQRFGLDKWSSL
PETPTLPAFFLGSLSISSTPCDTFLKLEGWEKGVVFINGQNLGRYWNIGPQKTLYLPGPW
LSSGINQVIVFEETMAGPALQFTETPHLGRNQYIK
Download sequence
Identical sequences ENSGGOP00000002321 ENSGGOP00000002321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]