SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002356 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002356
Domain Number 1 Region: 178-285
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 5.61e-34
Family ProC C-terminal domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 21-177
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.5e-30
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002356   Gene: ENSGGOG00000002393   Transcript: ENSGGOT00000002407
Sequence length 286
Comment pep:known_by_projection chromosome:gorGor3.1:8:143789220:143794561:-1 gene:ENSGGOG00000002393 transcript:ENSGGOT00000002407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGERSGVRGNKMAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNL
CHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLS
TLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETRLLQHLLEACGRCEEVPEA
YVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPA
QLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRK
Download sequence
Identical sequences G3QIY3
ENSGGOP00000002356 ENSGGOP00000002356 XP_004047682.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]