SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002377 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002377
Domain Number 1 Region: 134-433
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.62e-104
Family Pancreatic carboxypeptidases 0.000000264
Further Details:      
 
Domain Number 2 Region: 35-128
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 3.19e-23
Family Pancreatic carboxypeptidase, activation domain 0.0000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002377   Gene: ENSGGOG00000002414   Transcript: ENSGGOT00000002428
Sequence length 439
Comment pep:known_by_projection chromosome:gorGor3.1:7:128511188:128535118:1 gene:ENSGGOG00000002414 transcript:ENSGGOT00000002428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGTPGGGTRPGPSPVDRRILLVFSFILAAALGQMNFTGDQVLRVLAKDEKQLSLLRDLE
GLKPQKVNKVDFWRGPARTSLPVDMRVPFSELKDIKVYLESHGLAYSIMIKDIQVLLDEE
REAMAKSRRLERSTNSFSYSSYHTLEEIYSWIDNFVMEHSNIVSKIQIGNSFENQSILVL
KFSTGGSRHPAIWIDTGIHSREWITHATGIWTANKIVSDYGKDRVLTDILNAMDIFIELV
TNPDGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGGNGSNSNPCSETYHGPSP
QSEPEVAAIVNFITAHGNFKALISIHSYSQMLMYPYGRSLEPVSNQRELYDLAKDAVEAL
YKVHGIEYIFGSISTTLYVASGITIDWAYDSGIKYAFSFELRDTGQYGFLLPATQIIPTA
QETWMALRTIMEHTLNHPY
Download sequence
Identical sequences ENSGGOP00000002377 ENSGGOP00000002377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]