SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002379 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002379
Domain Number 1 Region: 8-84
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-19
Family PDZ domain 0.0000769
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002379
Domain Number - Region: 312-329
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00713
Family LIM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002379   Gene: ENSGGOG00000002417   Transcript: ENSGGOT00000002430
Sequence length 366
Comment pep:known_by_projection chromosome:gorGor3.1:8:22453797:22469220:1 gene:ENSGGOG00000002417 transcript:ENSGGOT00000002430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGM
LHAEAQSKIRQSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSVRS
SYSSPTSLSPRACSPFSPPPSSSPLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQ
AGLGRAGDSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
SFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATPPKLHTCEKCSTSIANQAVRI
QEGRYRHPGCYTCADCGLNLKMRGHFWEDACAMEGMRLSLEALEGMVEGAKRRDRRKTRR
PIQPSW
Download sequence
Identical sequences G3QJ03
ENSGGOP00000002379 ENSGGOP00000002379 XP_004046805.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]