SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002380 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002380
Domain Number 1 Region: 114-414
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.39e-111
Family Pancreatic carboxypeptidases 0.00000000719
Further Details:      
 
Domain Number 2 Region: 18-108
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 8.5e-30
Family Pancreatic carboxypeptidase, activation domain 0.00000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002380   Gene: ENSGGOG00000002419   Transcript: ENSGGOT00000002431
Sequence length 420
Comment pep:known_by_projection chromosome:gorGor3.1:7:128546794:128554497:1 gene:ENSGGOG00000002419 transcript:ENSGGOT00000002431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHP
GSPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFQSRARSTDTFNY
TTYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIH
SREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIITNPDGFAFTHSTNRMWRKT
RSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNI
KAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQ
ASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAEETWLALLTIMEHTLNHPY
Download sequence
Identical sequences ENSGGOP00000002380 ENSGGOP00000002380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]