SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002395 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002395
Domain Number 1 Region: 15-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-79
Family Calponin-homology domain, CH-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 1327-1439
Classification Level Classification E-value
Superfamily E set domains 1.13e-35
Family Filamin repeat (rod domain) 0.0000196
Further Details:      
 
Domain Number 3 Region: 1517-1635
Classification Level Classification E-value
Superfamily E set domains 2.94e-35
Family Filamin repeat (rod domain) 0.00000286
Further Details:      
 
Domain Number 4 Region: 1441-1550
Classification Level Classification E-value
Superfamily E set domains 1.07e-32
Family Filamin repeat (rod domain) 0.0000187
Further Details:      
 
Domain Number 5 Region: 451-569
Classification Level Classification E-value
Superfamily E set domains 1.47e-31
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 6 Region: 1854-1949
Classification Level Classification E-value
Superfamily E set domains 6.14e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 7 Region: 1142-1248
Classification Level Classification E-value
Superfamily E set domains 8.01e-31
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 
Domain Number 8 Region: 2039-2132
Classification Level Classification E-value
Superfamily E set domains 2.56e-30
Family Filamin repeat (rod domain) 0.0000177
Further Details:      
 
Domain Number 9 Region: 667-774
Classification Level Classification E-value
Superfamily E set domains 3.27e-30
Family Filamin repeat (rod domain) 0.00045
Further Details:      
 
Domain Number 10 Region: 1060-1151
Classification Level Classification E-value
Superfamily E set domains 8.01e-30
Family Filamin repeat (rod domain) 0.00000971
Further Details:      
 
Domain Number 11 Region: 1238-1348
Classification Level Classification E-value
Superfamily E set domains 1e-29
Family Filamin repeat (rod domain) 0.0000163
Further Details:      
 
Domain Number 12 Region: 751-863
Classification Level Classification E-value
Superfamily E set domains 7.34e-28
Family Filamin repeat (rod domain) 0.00089
Further Details:      
 
Domain Number 13 Region: 855-966
Classification Level Classification E-value
Superfamily E set domains 2e-27
Family Filamin repeat (rod domain) 0.0005
Further Details:      
 
Domain Number 14 Region: 2312-2403
Classification Level Classification E-value
Superfamily E set domains 4.74e-27
Family Filamin repeat (rod domain) 0.00000655
Further Details:      
 
Domain Number 15 Region: 2634-2724
Classification Level Classification E-value
Superfamily E set domains 1.53e-26
Family Filamin repeat (rod domain) 0.00000305
Further Details:      
 
Domain Number 16 Region: 1624-1738
Classification Level Classification E-value
Superfamily E set domains 1.07e-25
Family Filamin repeat (rod domain) 0.0000668
Further Details:      
 
Domain Number 17 Region: 273-369
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 18 Region: 373-472
Classification Level Classification E-value
Superfamily E set domains 3.27e-25
Family Filamin repeat (rod domain) 0.00079
Further Details:      
 
Domain Number 19 Region: 560-660
Classification Level Classification E-value
Superfamily E set domains 5.67e-25
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 20 Region: 2503-2595
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.00000308
Further Details:      
 
Domain Number 21 Region: 2410-2500
Classification Level Classification E-value
Superfamily E set domains 2.54e-23
Family Filamin repeat (rod domain) 0.00000441
Further Details:      
 
Domain Number 22 Region: 950-1054
Classification Level Classification E-value
Superfamily E set domains 1.53e-21
Family Filamin repeat (rod domain) 0.0026
Further Details:      
 
Domain Number 23 Region: 2245-2326
Classification Level Classification E-value
Superfamily E set domains 1e-19
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 24 Region: 1957-2053
Classification Level Classification E-value
Superfamily E set domains 5.47e-18
Family Filamin repeat (rod domain) 0.0000946
Further Details:      
 
Domain Number 25 Region: 1793-1871
Classification Level Classification E-value
Superfamily E set domains 8.67e-17
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002395   Gene: ENSGGOG00000002420   Transcript: ENSGGOT00000002447
Sequence length 2725
Comment pep:known_by_projection chromosome:gorGor3.1:7:126962500:126990407:1 gene:ENSGGOG00000002420 transcript:ENSGGOT00000002447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL
QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN
FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV
QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE
RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR
RDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV
VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP
APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP
NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV
APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG
AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP
APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI
PGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE
EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV
VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVALLGPTGVAEPVEVRDNGDGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE
IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPH
EEEPSEVPQLRQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTG
EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSR
HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLP
TAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTAS
IRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGD
ASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY
CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKI
PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPA
VFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVP
QEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTR
EAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVP
VASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELD
SDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTT
GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGP
QHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVT
RGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKE
KGDYILIVKWGDESVPGSPFKVKVP
Download sequence
Identical sequences G3S085
ENSGGOP00000002395 XP_018886633.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]