SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002418 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002418
Domain Number 1 Region: 1-128,155-523
Classification Level Classification E-value
Superfamily SNF-like 4.05e-164
Family SNF-like 0.0000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002418   Gene: ENSGGOG00000004977   Transcript: ENSGGOT00000002471
Sequence length 552
Comment pep:novel chromosome:gorGor3.1:16:33503382:33528053:-1 gene:ENSGGOG00000004977 transcript:ENSGGOT00000002471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RETWTRQMDFIMSCVGFSVGLGNVWLFPYLCYKNGGGVFLIPGVLISLVGGIPIFFLELG
QFMKAGSINVWNICPLFKGLGYASMVIIFYCNSYYIMVLAWGFYYLVKSFTTTLPWATCG
HTWNTPDYVEIFRHEDCANASLANLTCDQLADHRSPVIKFWENKVLRLSGGLEVPGALNW
EVTLCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIYYL
KPDWSKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNHFNNNCYKDAIILALINSGTSF
FAGFVVFSILGFMAAEQGMHISKVAESGPGLAFIAYPRAVTLMPVPLWAALFFFMLLLLG
LDSQFVGVEGFITGLLDLLPASYYFRFQREISVALCCALHFVIDLSMVTDGGMYVFLLFD
YYSSSGTTLLWQAFWECVVMARVYGADRFTDDIACMIGYRPCPWMKWCWSFFTPLVCMGI
FIFNVVYYEPLVYNNTYVYPWWGEAIGWAFALSSMLCVLLHLPCCLLRAKGTMAECWQHL
TQPIWGLHHLEY
Download sequence
Identical sequences ENSGGOP00000002418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]