SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002434 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002434
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily GINS helical bundle-like 5.75e-50
Family PSF1 N-terminal domain-like 0.000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002434   Gene: ENSGGOG00000002473   Transcript: ENSGGOT00000002487
Sequence length 196
Comment pep:known_by_projection chromosome:gorGor3.1:20:26051333:26092300:1 gene:ENSGGOG00000002473 transcript:ENSGGOT00000002487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIP
TIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRS
LATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRW
KCEQLIRQGVLEHILS
Download sequence
Identical sequences G1S0I5 G3QJ52 H2QK44 Q14691
ENSGGOP00000002434 gi|126116594|ref|NP_066545.3| ENSP00000262460 HR204 HR5008 ENSGGOP00000002434 ENSPTRP00000022872 ENSNLEP00000019015 ENSPTRP00000022872 ENSNLEP00000019015 NP_066545.3.87134 NP_066545.3.92137 XP_003278552.1.23891 XP_004061975.1.27298 XP_009435237.1.37143 ENSP00000262460 ENSP00000262460 9598.ENSPTRP00000022872 9606.ENSP00000262460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]