SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002484 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002484
Domain Number 1 Region: 1-197
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.1e-51
Family Rhodopsin-like 0.0079
Further Details:      
 
Domain Number 2 Region: 197-312
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.65e-29
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002484   Gene: ENSGGOG00000002524   Transcript: ENSGGOT00000002537
Sequence length 312
Comment pep:novel chromosome:gorGor3.1:11:53302589:53318212:-1 gene:ENSGGOG00000002524 transcript:ENSGGOT00000002537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSPNHTIVTEFILLGLTDDPVLEKILFGVFLVIYLITLAGNLCMILLIRTNSHLQTPMY
FFLGHLSFVDICYSSNVTPNMLHNFLSEQKTISYAGCFTQCLLFIALVITEFYILASMAL
DRYVAICSPLHYSSRMSKNICVCLVTIPYMYGFLSGFSQSLLTFHLSFCGSLEINHFYCA
DPPLIMLACSDTHVKNTMLKKNHTALTEFVLLGLTDRAELQPLLFVVFLVIYLITVIGNV
SMILLIRSDSTLHTPMYFFLSHLSFVDLCYTTSVTPQMLVNFLSKRKTISFIGCFIQFHF
FIALVITDYYML
Download sequence
Identical sequences ENSGGOP00000002484 ENSGGOP00000002484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]