SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002490 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002490
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.24e-65
Family N-terminal domain of xrcc1 0.0000000837
Further Details:      
 
Domain Number 2 Region: 539-629
Classification Level Classification E-value
Superfamily BRCT domain 1.83e-22
Family DNA-repair protein XRCC1 0.00000643
Further Details:      
 
Domain Number 3 Region: 319-403
Classification Level Classification E-value
Superfamily BRCT domain 9.03e-22
Family BRCT domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002490   Gene: ENSGGOG00000002526   Transcript: ENSGGOT00000002543
Sequence length 633
Comment pep:known_by_projection chromosome:gorGor3.1:19:40746551:40780174:-1 gene:ENSGGOG00000002526 transcript:ENSGGOT00000002543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA
AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE
STNSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSISKPQE
SPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPR
GEGTEPRRPRAGPEDLGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHL
ICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRYLMAGPGSSSEEDEASHSGG
SGDEAPKLPQKRPQTKTKPIQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDN
GAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELP
DFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMD
NPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Download sequence
Identical sequences A0A2I2Y8B4
XP_004060921.1.27298 ENSGGOP00000002490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]