SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002506 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002506
Domain Number 1 Region: 416-561
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000000024
Family CBS-domain pair 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002506
Domain Number - Region: 654-707
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00199
Family cAMP-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002506   Gene: ENSGGOG00000002546   Transcript: ENSGGOT00000002559
Sequence length 951
Comment pep:known_by_projection chromosome:gorGor3.1:10:112764092:112831400:1 gene:ENSGGOG00000002546 transcript:ENSGGOT00000002559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAAAAVGVRLRDCCSRGAVLLLFFSLSPRPPAAAAWLLGLRPEDTAGGRVSLEGG
TLRAAEGTSFLLRVYFQPGPPATAAPVPSPTLNSGENGTGDWAPRLVFIEEPPGGSGVAP
SAVPTRPPGPQRCREQSDWASDVEVLGPLRPGGVAGSALVQVRVRELRKGEAERGGAGGG
GKLFSLCAWDGRAWHHHGAAGGFLLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALFS
GLRLSLLSLDPVELRVLRNSGSAAEQEQARRVQAVRGRGTHLLCTLLLGQAGANAALAGW
LYTSLPPGVGGAGEDYSEEGIHFPWLPALVCTGAVFLGAEICPYSVCSRHGLAIASHSVC
LTRLLMAAAFPVCYPLGRLLDWALRQEISTFYTREKLLETLRAADPYSDLVKEELNIIQG
ALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILF
VKDLAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQRVNNEGE
GDPFYEVMGIVTLEDIIEEIIKSEILDETDLYTDNRKKQRVPHRERKRHDFSLFKLSDTE
MRVKISPQLLLATHRFMATEVEPFKSLYLSEKILLRLLKHPNVIQELKFDEKNKKAPEHY
LYQRNRPVDYFVLLLQGKVEVEVGKEGLRFENGAFTYYGVPAIMTTACSDNDVRKVGSLA
GSSVFLNRSPSRCSGLNRSESPNRERSDFGGSNTQLYSSSNNLYMPDYSVHILSDVQFVK
ITRQQYQNALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSL
PCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLTLSPAAVPTRAASDSECCNI
NLDTETSPCSSDFEENVGKKLLRTLSGQKRKRSPEGERTSEDNSNLTPLIT
Download sequence
Identical sequences G3QJB7
ENSGGOP00000002506 ENSGGOP00000002506 XP_018891086.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]