SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002530 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002530
Domain Number 1 Region: 50-197
Classification Level Classification E-value
Superfamily EF-hand 1.75e-34
Family Calmodulin-like 0.0000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002530   Gene: ENSGGOG00000002568   Transcript: ENSGGOT00000002583
Sequence length 199
Comment pep:known_by_projection chromosome:gorGor3.1:3:48092148:48097772:-1 gene:ENSGGOG00000002568 transcript:ENSGGOT00000002583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPPMAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKE
AFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLP
MLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQ
EDSNGCINYEAFVKHIMSS
Download sequence
Identical sequences ENSGGOP00000002530 ENSGGOP00000002530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]