SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002541 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002541
Domain Number 1 Region: 40-377
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.81e-61
Family WD40-repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 374-420
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000011
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002541   Gene: ENSGGOG00000002578   Transcript: ENSGGOT00000002594
Sequence length 421
Comment pep:known_by_projection chromosome:gorGor3.1:12:117800700:117831295:-1 gene:ENSGGOG00000002578 transcript:ENSGGOT00000002594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVDRESRFLRGTGTGEAVAVEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAW
SQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWP
SPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTP
SGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFL
WSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVD
PAMDDSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFP
HGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRT
F
Download sequence
Identical sequences A0A2I2YQM0 A0A2I3TEV3
XP_004054016.1.27298 ENSGGOP00000002541 ENSGGOP00000002541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]