SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002550 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002550
Domain Number 1 Region: 31-83
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000405
Family Hairy Orange domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002550
Domain Number - Region: 4-26
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0018
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002550   Gene: ENSGGOG00000002589   Transcript: ENSGGOT00000002603
Sequence length 257
Comment pep:known_by_projection chromosome:gorGor3.1:6:126194666:126201466:1 gene:ENSGGOG00000002589 transcript:ENSGGOT00000002603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSV
EGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPN
GLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCVPPLSTSLLSL
SATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAATAISPPLSVSATSSPQQTSS
GTNNKPYRPWGTEVGAF
Download sequence
Identical sequences G3QJF6
ENSGGOP00000002550 ENSGGOP00000002550 XP_018884392.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]