SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002565 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002565
Domain Number 1 Region: 38-255
Classification Level Classification E-value
Superfamily t-snare proteins 2.59e-52
Family t-snare proteins 0.00000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002565   Gene: ENSGGOG00000002602   Transcript: ENSGGOT00000002618
Sequence length 297
Comment pep:known_by_projection chromosome:gorGor3.1:16:31800575:31807175:1 gene:ENSGGOG00000002602 transcript:ENSGGOT00000002618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQ
ELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNT
RMRKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSG
QSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINR
IEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG
Download sequence
Identical sequences G3QJH0 K7BT43 Q12846
NP_004595.2.87134 NP_004595.2.92137 XP_003807531.1.60992 XP_004057576.1.27298 XP_016785219.1.37143 ENSGGOP00000002565 ENSGGOP00000002565 ENSP00000390788 ENSP00000317714 ENSP00000317714 9606.ENSP00000317714 gi|20149560|ref|NP_004595.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]