SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002585 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002585
Domain Number 1 Region: 15-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-53
Family SPRY domain 0.00000000546
Further Details:      
 
Domain Number 2 Region: 221-262
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000706
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002585   Gene: ENSGGOG00000002625   Transcript: ENSGGOT00000002639
Sequence length 263
Comment pep:known_by_projection chromosome:gorGor3.1:12:7070626:7072958:-1 gene:ENSGGOG00000002625 transcript:ENSGGOT00000002639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVK
EGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHY
AALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGY
AIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHTLG
DTRLGQVSALPLPPAMKRYLLYQ
Download sequence
Identical sequences G3QJI9 K7CZ22
ENSGGOP00000002585 XP_008971918.1.60992 XP_009422993.2.37143 XP_018893512.1.27298 ENSGGOP00000002585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]