SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002592 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002592
Domain Number 1 Region: 41-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 154-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000633
Family Pentraxin (pentaxin) 0.0049
Further Details:      
 
Domain Number 3 Region: 863-1143
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000302
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002592   Gene: ENSGGOG00000002626   Transcript: ENSGGOT00000002646
Sequence length 1224
Comment pep:known_by_projection chromosome:gorGor3.1:6:143198416:143275510:1 gene:ENSGGOG00000002626 transcript:ENSGGOT00000002646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFFFSSRGFHFPFIFYDCMLVFLNIYCLIVPIWPAVWGCANCRVVLSNPSGTFTSPCYPN
DYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLS
FNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPE
LSAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPV
KEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNE
IVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCDQG
SYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVV
IQNILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLV
LWALLVYNATNNTNLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLGHCLAMEEPKGYYWP
SIQPSEYVLPCPDKPGFSASRICFYNATNPLVTYWGPVDISNCLKEANEVANQILNLTAD
GQNLTSANITNIVEQVKRIVNKEENIDITLGSTLMNIFSNILSSSDSDLLESSSEALKTI
DELAFKIDLNSTSHVNITTRNLALGVSSLLPGTNAISNFSIGLPSNNESYFQMDFESGQV
DPLASVILPPNLLENLSQEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVMACSIGNI
TIQNLKDPVQIKIKHTRIQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLC
NHFTHFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYP
SKILMNLSTALLFLNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYI
ALVKVFNTYIRRYILKFCIIGWGLPALVVSVVLASRNNNEVYGKESYGKEKGDEFCWIQD
PVIFYVTCAGYFGVMFFLNIAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSLTFLL
GMTWGFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGRFRLA
DNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHTDNVSYE
HSFNKSGSLRQCFHGQVLVKTGPC
Download sequence
Identical sequences ENSGGOP00000002592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]