SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002603 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002603
Domain Number 1 Region: 92-219
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-21
Family cAMP-binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 227-295,409-471
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000415
Family cAMP-binding domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002603   Gene: ENSGGOG00000002640   Transcript: ENSGGOT00000002657
Sequence length 576
Comment pep:known_by_projection chromosome:gorGor3.1:20:33367896:33432891:1 gene:ENSGGOG00000002640 transcript:ENSGGOT00000002657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRHMVTYAWQLLKKELGLYQLAMDIIIMIRVCKMFRQGLRGFREYQIIETAHWKHPIFS
FWDKKMQSRVTFDTMDFIAEEGHFPPKAIQIMQKKPSLRTEDEIQAVCNILQVLHSYRNY
AEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAITKDEDGSSAFLDPHPKL
LHKGSCFGETDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRK
MELFASWSDEKLWQLVAMAKIEKFSYGQLISKDFGESPFIMFISKGSCEVLRLLDLGASP
SYHRWIWQHLELIDDRPLKTHLSEYSPMERFKEFQIKSYPLQDFSSLKLLHLKKAWGLQG
TSFSRKIRTSGDTLPKMLGPKIQSRPAQSIKCAMINTKLGELPKEAAVGAYVKVHTVEQG
EILGLHQAFLPEGECDTRPLILMSLGNELIRIRKEIFYELIDNDDEMIKKLLKLNIAFPS
DEDMCQKFLQQNSWNIFRKDLLQLLVEPCQSQLFTPNRPKKKEIYNPKSVVLDLCSINKT
TKPRYPIFMAPQKYLPPLRIVQAIKAPRYKIRELLA
Download sequence
Identical sequences G3QJK6
ENSGGOP00000002603 XP_018872602.1.27298 ENSGGOP00000002603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]