SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002618 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002618
Domain Number 1 Region: 212-437
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-30
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 2 Region: 682-829
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000232
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 1524-1598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1590-1647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000514
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Domain Number 5 Region: 541-631,720-771
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000089
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 6 Region: 1469-1530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000195
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Domain Number 7 Region: 837-879,1063-1107
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000283
Family Fibronectin type III 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002618
Domain Number - Region: 1417-1467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00332
Family Complement control module/SCR domain 0.008
Further Details:      
 
Domain Number - Region: 1728-1758
Classification Level Classification E-value
Superfamily Notch domain 0.0235
Family Notch domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002618   Gene: ENSGGOG00000002653   Transcript: ENSGGOT00000002672
Sequence length 1791
Comment pep:known_by_projection chromosome:gorGor3.1:1:155801404:156185213:1 gene:ENSGGOG00000002653 transcript:ENSGGOT00000002672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCLKILRISLAILAGWALCSANSELGWTRKKSLVEREHLNQVLLEGERCWLGAKVRRPR
ASPQHHLFGVYPSRAGNYLRPYPVGEQEIHHTGRSKPDTEGNAVSLVPRDLTENPAGLRG
AVEQPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLGEAGIQKGSAMAATTTTAIFTTL
NEPKPETQRRGWAKSRQRRQVWKRRAEDVQGDSGISSHFQPWPKHSLKHRVKKSPLEESN
QNGGEGSYREAETFNSQVGLPILYFSGRRERLLLRPEVLAEIPREAFTVEAWVKPEGGQN
NPAIIAGVFDNCSHTVSDKGWALGIRSGKDKGKRDARFFFSLCTDRVKKATILISHSRYQ
PGTWTHVAATYDGRHMALYVDGTQVASSLDQSGPLNSPFMASCRSLLLGGDSSEDGHYFR
GHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEV
LQGFEPEPEILSPLQPPLCGQTVCDNVELISQYNGYWPLRGEKVIRYQVVNICDDEGLNP
IVSEKQIRLQHEALNEAFSRYNISWQLSVHQVHNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGYDGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPQVADVRKTCFDPD
SPKRAYMSVKELKEALQLNSTHFLNIYFASSVREDLAGAATWPWDKDAVTHLGGIVLSPA
YYGMPGHTDTMIHEVGHVLGLYHVFKGVSERESCNDPCKETVPSMETGDLCADTAPTPKS
ELCREPEPTSDTCGFTRFPGAPFTNYMSYTDDNCTDNFTPNQVARMHCYLDLVYQQWTES
RKPTPIPIPPMVIGQTNKSLTIHWLPPISGVVYDRASGSLCGACTEDGTFRQYVHTASSR
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPEVHLYHMNMTVPCPTEGCSLELLFQHP
VQADTLTLWVTSFFMESSQVLFDTEILLENKESVHLGPLDTFCDIPLTIKLHVDGKVSGV
KVYTFDERIEIDAALLTSQPHSPLCSGCRPVRYQVLRDPPFASGLPVVVTHSHRKFTDVE
VTPGQMYQYQVLAEAGGELGEASPPLNHIHGAPYCGDGKVSERLGEECDDGDLVSGDGCS
KVCELEEGFNCVGEPSLCYMYEGDGICEPFERKTSIVDCGIYTPKGYLDQWATRAYSSHE
DKKKCPVSLVTGEPHSLICTSYHPDLPNHRPLTGWFPCVASENETQDDRSEQPEGSLKKG
DEVWLQVCFNRPGEARAIFIFLTTDGLVPGEHQQPTVTLYLTDVRGSNHSLGTYGLSCQH
NPLIINVTHHKNVLFHHTTSVLLNFSSPRVGISAVALRTFSHIGLSAPSNCISEDEGQNH
QGQSCIHRPCGKQDSCPSLLLDHADVVNCTSIGLGLMKCAITCQRGFALQASSGQYIRPM
QKEILLTCSSGHWDQNVSCLPVDCGVPDPSLVNYANFSCSEGTNFLKRCSISCVPPAKLQ
GLSPWLTCLEDGLWSLPEVYCKLECDAPPVILNANLLLPHCLQDNHDVGTICKYECKPGY
YVAESAEGKVRNKLLKIQCLEGGIWEQGSCIPVVCEPPPPVFEGMYECTNGFSLDSQCVL
NCNQEREKLPILCTKEGLWTQEFKLCENLQGECPPPPSELNSVEYKCEQGYGIGAVCSPL
CVIPPSDPVMLPENITADTLEHWMEPVKVQSIVCTGRRQWHPDPVLVHCIQSCEPFQADG
WCDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
Download sequence
Identical sequences G3QJM0
XP_004027999.1.27298 ENSGGOP00000002618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]