SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002621 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002621
Domain Number 1 Region: 284-484
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 1.31e-75
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0000000111
Further Details:      
 
Domain Number 2 Region: 7-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-69
Family G proteins 0.00000000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002621   Gene: ENSGGOG00000002661   Transcript: ENSGGOT00000002675
Sequence length 484
Comment pep:known_by_projection chromosome:gorGor3.1:1:91489831:91498210:-1 gene:ENSGGOG00000002661 transcript:ENSGGOT00000002675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAG
KKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV
LLSSTFVYNSMGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVW
TLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR
PVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTY
VNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDLHRDS
EREAIKVFIRSSFKDVDHLFQKELAAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEV
ERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLA
LKLQ
Download sequence
Identical sequences ENSGGOP00000002621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]