SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002634 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002634
Domain Number 1 Region: 66-325
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.64e-31
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 381-429
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000085
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002634   Gene: ENSGGOG00000002672   Transcript: ENSGGOT00000002688
Sequence length 437
Comment pep:known_by_projection chromosome:gorGor3.1:9:113206481:113211740:-1 gene:ENSGGOG00000002672 transcript:ENSGGOT00000002688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRQKARPPCCAGPAAMPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVAS
EESRILVLTELLDRKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYY
TALHIAVLRNQPDMVELLVHHGADVNRRDRIHESSPLDLASEEPERLPCLQRLLDLGADV
NAADKHGKTALLHALASSDGVQIHNTENIRLLLEGGADVKATTKDGDTVFTCIIFLLGET
VGGDKEEAQMINRFCFQVTRLLLAHGADPSECPAHESLTHICLKSFKLHFPLLRFLLESG
AAYNCSLHGASCWSGFHIIFERLCSHPGCTEDESHADLLRKAETVLDLMVTNSQKLQLPE
NFDIHPVGSLAEKIQALHFSLRQLESYPPPLKHLCRVAIRLYLQPWPVDVKVKALPLPDR
LKWYLLSEHSGSVEDDI
Download sequence
Identical sequences ENSGGOP00000002634 ENSGGOP00000002634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]