SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002643 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002643
Domain Number 1 Region: 30-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-62
Family Lectin leg-like 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002643   Gene: ENSGGOG00000002678   Transcript: ENSGGOT00000002697
Sequence length 526
Comment pep:known_by_projection chromosome:gorGor3.1:15:54435872:54448656:1 gene:ENSGGOG00000002678 transcript:ENSGGOT00000002697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVSGPGHLFCLLLLLLDPHSPETGGPPLRRFEYKLSFKGPRLALPGAGIPFWSHHGDA
ILGLEEVRLTPSMRNGSGAVWSRASVPFSAWEVEVQMRVTGLGRRGAQGMAMWYTQGRGH
VGSVLAGLASWDGIGIFFDSSAEDTQDSPAIRVLASDGHIPSEQPGDGASQVLGSCHWDF
RKRPHPFRARITYWGQRLHVSLNSGLTPSDPDEFCVDVGPLLLVPGGFFGVSAATGTLAD
DHDVLSFLTFSLNEPSPEVPPQPFLEMQQLRLARQLEGLRARLGLGAREAVTPKSDSEAQ
GEGETLFDLEETLGRHHQILQALRGLSKQLAQAERQWKKQLGPPGQARPDGGWALDASCQ
IPSTPGRGGHLSMSLNKDSAKVGALLHGQWTLFQALQEMRDAAVRMAAEAQVSYLPVGTE
HHFLELDHILGLLQEELRGPAKAAAKAPRPPGQPPRASSCLQPGIFLFYLLIQTVGFFGY
VHFRQELNKSLQECLSTGSLPLGPAPHTPRAPGILRRQPLPASMPA
Download sequence
Identical sequences G3QJP2
XP_004056567.1.27298 ENSGGOP00000002643 ENSGGOP00000002643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]