SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002644 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002644
Domain Number 1 Region: 229-298
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002644
Domain Number - Region: 288-377
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0392
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002644   Gene: ENSGGOG00000002683   Transcript: ENSGGOT00000002698
Sequence length 476
Comment pep:known_by_projection chromosome:gorGor3.1:6:42892738:42900034:-1 gene:ENSGGOG00000002683 transcript:ENSGGOT00000002698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REPAPAATMASRIGLRMQLMREQAQQEEQRERMQQQAVMHYLGGPPTPAINTPVHFQSPP
PVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASP
GVRAGHVLSSSAGNSAPNSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQMPNT
LPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTGPPDAESRALAKERQKKDNH
NLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELEN
HSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEAL
MLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPG
HGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences ENSGGOP00000002644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]