SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002660 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002660
Domain Number 1 Region: 85-175
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000000000488
Family HSP20 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002660   Gene: ENSGGOG00000002700   Transcript: ENSGGOT00000002714
Sequence length 205
Comment pep:known_by_projection chromosome:gorGor3.1:7:73377299:73379046:1 gene:ENSGGOG00000002700 transcript:ENSGGOT00000002714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
IPVTFESRAQLGGPEAAKSDETAAK
Download sequence
Identical sequences A0A2K5VTS1 A0A2K6AVS5 F6XTF7 G3QJQ8 H2QUT1 P04792 V9HW43
ENSP00000248553 ENSMMUP00000005514 ENSPTRP00000033044 9544.ENSMMUP00000005514 9606.ENSP00000248553 ENSP00000248553 ENSP00000248553 ENSMMUP00000005514 ENSPTRP00000033044 GO.37493 HR6387 ENSGGOP00000002660 ENSGGOP00000002660 NP_001247878.1.72884 NP_001531.1.87134 NP_001531.1.92137 XP_004045665.1.27298 XP_011758335.1.29376 XP_519162.3.37143 gi|4504517|ref|NP_001531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]