SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002708 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002708
Domain Number 1 Region: 313-558
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.6e-89
Family Eukaryotic proteases 0.0000347
Further Details:      
 
Domain Number 2 Region: 223-319
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-18
Family Hepsin, N-terminal domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002708
Domain Number - Region: 202-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000127
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002708   Gene: ENSGGOG00000002744   Transcript: ENSGGOT00000002762
Sequence length 585
Comment pep:known_by_projection chromosome:gorGor3.1:11:115837914:115854337:-1 gene:ENSGGOG00000002744 transcript:ENSGGOT00000002762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETNRHGNASPARTPSAGASPAQASAAGTPPGRASPAQASPAQASPAGTPLGRASPAQASP
AGTPPGRASPAQASPAQASPAQASPARASPALASPSRSSSGRSSSARSASVTTSPTRVYL
VRATPVGAVPVRSSPARSAPATRATRESPGTSLPKFTWREGQKRLPLIGCVLLLIALVVS
LIILFQFWRDQTGIRYKEQRESCPKHAVRCDGVVDCKLKSDELGCVRFDWDKSLLKIYSG
SSHQWLPICSSNWNDSYSEKTCQQLGFESAYRTTEVAHRDFANSFSILRYNSTIQESLHR
SECPSQRYISLQCSHCGLRAMTGRIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWV
LTAAHCFFVTREKVLEGWKVYAGTSNLNQLPEAASIAEIIINSNYTDEEDDYDIALMRLS
KPLTLSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCN
DYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKP
GVYTKVTEVLPWIYSKMEVRSLQQDTAPSRLGTSSGGDPGGARRV
Download sequence
Identical sequences ENSGGOP00000002708 ENSGGOP00000028487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]