SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002713 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002713
Domain Number 1 Region: 365-598
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 1080-1162,1214-1368
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.92e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 2-134,183-254
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 794-915,955-1033
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.98e-26
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002713
Domain Number - Region: 742-794
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000212
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Domain Number - Region: 1373-1520
Classification Level Classification E-value
Superfamily EF-hand 0.0195
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002713   Gene: ENSGGOG00000002738   Transcript: ENSGGOT00000002767
Sequence length 2062
Comment pep:known_by_projection chromosome:gorGor3.1:12:2494213:2774242:1 gene:ENSGGOG00000002738 transcript:ENSGGOT00000002767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKAD
GANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVI
IIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGP
KHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNL
VLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEE
KPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRA
AVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLG
LQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSN
LVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTV
FQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADA
ESLTSAQKEEEEEKERKKLARTASPEKKQELVEKPAVGESKEEKIELKSITADGESPPAT
KINMDDLQPNENEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASA
FFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIV
FTTIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSV
SLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLL
QFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFD
NVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMN
IFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNST
YFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYF
SDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQC
SPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLF
FIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKC
APESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGP
HHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLN
SDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDD
EVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISG
DLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHIN
KAGSSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTV
EGHGPPLSPAIRVQEVAWKLSSNRARHVLVCEDLELRRDSGSAGTQAHCLLLRRANPSRC
HSRESQAAMAGQEETSQDETCEVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDK
RDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLS
PLLQRSHSPASFPRPFATPPATPGSRGWPPQPIPTLRLEGVESSEKLNSSFPSIHCGSWA
ETTPGGGGSSAARRARPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFI
EVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGC
VRARGRLSEEELQDSRVYVSSL
Download sequence
Identical sequences ENSGGOP00000002713 ENSGGOP00000002713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]