SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002719 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002719
Domain Number 1 Region: 562-633
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000207
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 500-567
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000218
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002719
Domain Number - Region: 472-498
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00159
Family LIM domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002719   Gene: ENSGGOG00000002756   Transcript: ENSGGOT00000002773
Sequence length 676
Comment pep:known_by_projection chromosome:gorGor3.1:3:46789660:46875583:1 gene:ENSGGOG00000002756 transcript:ENSGGOT00000002773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQ
QQQLLQEETLPRGSRGPVNGGGRLGPQARREVVGSKLTVDGAAKPPLAASTGAPGAVTTL
AAGQPPYPPQEQRSRPYLHGTRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYY
DNLSLASPKWGDKPAVSPSIGLSVGSGWPSSPGSDPPLPKPCGDHPLNHRQLSLSSSRSS
EGSLGGQNSGTGGRSSEKPTGLWSTASSQRVSPGLPSPNLENGAPALGPVQPRTPYVSAP
LALSCPRQGGLPRSNSGLGGEVSGVMSKPNVDPQPWFQDGPKSYLSSSALSSSPAGLDGS
QQGAVPGLGPKPGCTDLGTGPKLSPTSLVHPVMSTLPELSCKEGPLGWSSDGSLGSVLLD
SPSSPRVRLPCQPLVPGPELRPSAAELKLEALTQRLEREMDAHPKADYFGACVKCSKGVF
GAGQACQAMGNLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLC
GHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAAC
GLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVK
RLEKRPSSTALHQHHF
Download sequence
Identical sequences ENSGGOP00000002719 ENSGGOP00000002719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]