SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002726 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002726
Domain Number 1 Region: 74-328
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.69e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000289
Further Details:      
 
Domain Number 2 Region: 334-466
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.67e-29
Family Ricin B-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002726   Gene: ENSGGOG00000002766   Transcript: ENSGGOT00000002783
Sequence length 481
Comment pep:known_by_projection chromosome:gorGor3.1:4:182811473:183642227:1 gene:ENSGGOG00000002766 transcript:ENSGGOT00000002783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYREN
GFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINR
TPGSLIAEIILVDDFSEREHLKDKLEEYMARFSKVRIVRTKKREGLIRTRLLGASMARGE
VLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWE
MYYKRIPIPPELQRADPSDPFESPVMAGGLFAVNRKWFWELGGYDPGLEIWGGEQYEISF
KVWMCGGEMFDVPCSRVGHIYRKYVPYKVPSGTSLARIRNVAANLCVDSKHGATGTELRL
DICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQ
LWGYRKDRTLFHPVSNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKFNQHAN
S
Download sequence
Identical sequences ENSGGOP00000002726 ENSGGOP00000002726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]