SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002734 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002734
Domain Number 1 Region: 257-445,756-903
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-116
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000573
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily DUSP-like 7.19e-29
Family DUSP, domain in ubiquitin-specific proteases 0.00000208
Further Details:      
 
Domain Number 3 Region: 471-573
Classification Level Classification E-value
Superfamily EPT/RTPC-like 0.000000085
Family RNA 3'-terminal phosphate cyclase, RPTC 0.025
Further Details:      
 
Domain Number 4 Region: 117-188
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000709
Family UBX domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002734   Gene: ENSGGOG00000002771   Transcript: ENSGGOT00000002792
Sequence length 952
Comment pep:known_by_projection chromosome:gorGor3.1:12:60556402:60670391:1 gene:ENSGGOG00000002771 transcript:ENSGGOT00000002792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKADGDAQSLKEHLIDELDY
ILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVT
RRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVL
VIEQKNEDGTWPRGPSTPKSPGASNFSTLPKISPSSLSNNYNNMNNRNVKNSNYCLPSYT
AYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFD
NPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLL
DGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCP
ECAKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLTKPMQYKVVVPKIGNILDLCTAL
SALSGIPADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEININRTEDTEHVIIPV
CLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNTEDKLYNLLLLRMCRYVKISTETEETEG
SLHCCKDQNINGNGPNGIHEEGSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDND
SENGLCTEDTCKGQLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQLRLDERSFL
ALDWDPDLKKRYFDENAAEDFEKHESVEYKPPKKPFVKLKDCIELFTTKEKLGAEDPWYC
PNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPINDLDMSEFLINPN
AGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLF
YQRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDIENENCMHTN
Download sequence
Identical sequences ENSGGOP00000002734 ENSGGOP00000002734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]