SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002740 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002740
Domain Number 1 Region: 635-673
Classification Level Classification E-value
Superfamily SAP domain 0.000000256
Family SAP domain 0.0024
Further Details:      
 
Domain Number 2 Region: 924-968
Classification Level Classification E-value
Superfamily EF-hand 0.0000295
Family Calmodulin-like 0.064
Further Details:      
 
Domain Number 3 Region: 146-207
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000454
Family Cold shock DNA-binding domain-like 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002740
Domain Number - Region: 1036-1125
Classification Level Classification E-value
Superfamily Tropomyosin 0.00216
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002740   Gene: ENSGGOG00000002776   Transcript: ENSGGOT00000002798
Sequence length 1150
Comment pep:known_by_projection chromosome:gorGor3.1:10:81181272:81252302:1 gene:ENSGGOG00000002776 transcript:ENSGGOT00000002798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPAN
YQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLS
TPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTP
QVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQT
QPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVRIVSQPQPARRLDPPSR
FSGRNDRGDQVPNRKDDRSRERERERRRSRERSPQRKRSRERSPRRERERSPRRVRRVVP
RYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFY
VMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQH
PARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCT
QWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEK
LQGERKEADGEQDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKS
QLIARLTKQLKVEEQKEEQKELEKSEKEEDEDDDRKSEDDKEEEERKRQEEIERQRRERR
YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQR
DFGVRIYKSLLSLPEKEDKKEKDKKSKKDERKDKKEERDDETDEPKPKRRKSGDDKDKKE
DRDERKKEDKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDIN
RYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQ
VKKLLNKVVLRESCFYRKLTDTSKDEENHEESESLQEDMLGNRLLLPTPTVKQESKDVEE
NVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLS
GELREVKKDLSQLQENLKISENMNSQFENQLNKTIRNLSTVMDEIHTVLKKDNVKNEDKD
QKSKENGANV
Download sequence
Identical sequences A0A2I2ZNX5
ENSGGOP00000002740 XP_018890652.1.27298 XP_018890653.1.27298 XP_018890654.1.27298 ENSGGOP00000002740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]