SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002743 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002743
Domain Number 1 Region: 31-139
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.81e-36
Family Cystatins 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002743   Gene: ENSGGOG00000002786   Transcript: ENSGGOT00000002801
Sequence length 141
Comment pep:known_by_projection chromosome:gorGor3.1:20:24349217:24352601:-1 gene:ENSGGOG00000002786 transcript:ENSGGOT00000002801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARHLSTLLLLLATLAVALAWSPKEEDRIILGGIYDADLNDEWVQRALHFAISEYNKATK
DDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQLNLDTCAFHEQPELQKKQLCSF
EIYEVPWENRRSLVKSRCQEA
Download sequence
Identical sequences G3QJY3
XP_004061957.1.27298 ENSGGOP00000002743 ENSGGOP00000002743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]