SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002757 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002757
Domain Number 1 Region: 77-118,168-413
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.46e-53
Family beta-glycanases 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002757   Gene: ENSGGOG00000002800   Transcript: ENSGGOT00000002815
Sequence length 543
Comment pep:known_by_projection chromosome:gorGor3.1:4:92128058:92170134:-1 gene:ENSGGOG00000002800 transcript:ENSGGOT00000002815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVT
IDANLATDPRFLIFLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQS
QVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCS
GLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKRYNISWELGNEPNSFLKKADIFINGS
QLGEDFIQLHKLLRKSPFKNAKLYGPDVGQPRRKTTKMLKSFLKAGGEVIDSVTWHHYYL
NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFA
AGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLM
ASVKGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYLFFNKQVDKYLL
RPLGPHGLLSKSVQLNGQTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVA
ACI
Download sequence
Identical sequences ENSGGOP00000002757 ENSGGOP00000002757 ENSGGOP00000017789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]