SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002781 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002781
Domain Number 1 Region: 59-422
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.34e-62
Family Ankyrin repeat 0.0000447
Further Details:      
 
Domain Number 2 Region: 525-576
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000706
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002781   Gene: ENSGGOG00000002824   Transcript: ENSGGOT00000002841
Sequence length 587
Comment pep:known_by_projection chromosome:gorGor3.1:3:58777702:58793272:-1 gene:ENSGGOG00000002824 transcript:ENSGGOT00000002841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNYTSDEDIDEDFDTQLIIQQSLQDIYKPGTAQHAPKDESFHSFLSADYKKIVETIEKG
KEDALSHLTKYHSAFDETDEIGWIPLHKAAVQLNRKILEITLSASDPSLWEQTTHNGETP
LFLAVSSCLLENATFLLLNGCNPNAKNFEGNSPLLTAVLRDCYDMAALLINYGADVNLRC
ANERTALHEAAKLGREDMVKLMLVSGAHPDPQSTYGFTPLALAAQSGHTEIMEMLLRKGA
NAHGQASDSSSILLEAASGGNPDAVALLLEYGADANIPKNSGHLPIHVAADRGHLLALKI
LIPVTDLAAIKQSGISPVHCAAAGAHPQCLELLIQAGFDVNFMLDQRINKHYDDHRKSAL
YFAVSNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNP
LHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTVEGWTSTVIKDTKFCE
VITLSWLQHLSGKVVRVMLDYVDQVRICSKLKAVLQKQGIWSEIHFILTNPRSLKHLCRL
KIRKCMGRLHLRCPVFMSFLPLPNRLKAYVLYKEYDLYGQGIFTGTW
Download sequence
Identical sequences ENSGGOP00000002781 ENSGGOP00000002781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]