SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002790 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002790
Domain Number 1 Region: 653-680
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000017
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002790
Domain Number - Region: 708-730
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00811
Family CCCH zinc finger 0.0034
Further Details:      
 
Domain Number - Region: 679-704
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0981
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002790   Gene: ENSGGOG00000002833   Transcript: ENSGGOT00000002851
Sequence length 762
Comment pep:known_by_projection chromosome:gorGor3.1:8:143613806:143724819:-1 gene:ENSGGOG00000002833 transcript:ENSGGOT00000002851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIDDYKTLHGNAPAPGTPAASGWQPPTYHSGRVFSARYPRPSRRGYSSHHGPSWRKKYSL
VNRPPGPSDPPADHAVRPLHEARGCQAPVPQQHVLEGQVQLSQGQNVVIKVKPPSKSGSA
SASGAQRGSLEEYEDTPWSDQRPREGEGEPPWGQLQPSRPTRARGTCSVEDPLLVCQKEP
GKPRMVKSVGSVGDSPREPRRTVSESVIAVKASFPSSPLPPRTGVALGRKLGSHSVASCA
PQLLGDRRVDAGHTDQPVPSGSVGGPARPASGPRQAREASLVVTCRTNKFRKNNYKWVAA
SAKSPRAARRALSPRVAAENVCKASAGMANKVEKPQLIADPEPKPRKPATSSKPGSAPSK
YKWKASSPSASSSSSFRWQSEAGSKDHASQLSPVLSRSPSGDRPAVGHSGLKPLSGETPL
SAYKVKSRTKIIRRRGSTSLPGDKKSSTSPATTTKSHLSLRRRQALRGKSSPVLKKTPNK
GLVQVTTHRLCRLPPSRAHLPTKEASSLHAVRTAPTSKVIKTRYRIVKKTPASPLSAPPF
PLSLPSWRARRLSLSRSLVLNRLRPVASGGGKAQPGSPRWRSKGYRCIGGVLYKVSANKL
SKTSGQPSDAGSRPLLRTGRLDPAGSCSRSLASRAVQRSLAIIRQARQRREKRKEYCMYY
NRFGRCNRGERCPYIHDPEKVAVCTRFVRGTCKKTDGTCPFSHHVSKEKMPVCSYFLKGI
CSNSNCPYSHVYVSRKAEVCSDFLKGYCPLGAKKPLHIKPRL
Download sequence
Identical sequences ENSGGOP00000002790 ENSGGOP00000002790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]