SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002805 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002805
Domain Number 1 Region: 126-627
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.15e-158
Family Calponin-homology domain, CH-domain 0.00000000282
Further Details:      
 
Domain Number 2 Region: 11-101
Classification Level Classification E-value
Superfamily EF-hand 6.01e-20
Family Calmodulin-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002805   Gene: ENSGGOG00000002849   Transcript: ENSGGOT00000002867
Sequence length 635
Comment pep:known_by_projection chromosome:gorGor3.1:3:142884605:143037234:1 gene:ENSGGOG00000002849 transcript:ENSGGOT00000002867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLFCPKMENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVRE
IVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSE
GTQHSYSEEEKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEP
DTIDERAINKKKLTPFTISENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQII
KVGLFADIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLTNAGWHTISNFSQD
IKDSRAYFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQFVTPA
DVVSGNPKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYI
NHLYSDLADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKF
SLVGIAGQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSAN
KKTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKI
GARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK
Download sequence
Identical sequences ENSGGOP00000002805 ENSGGOP00000002805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]