SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002812 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002812
Domain Number 1 Region: 49-499
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 1.83e-144
Family Class I alpha-1;2-mannosidase, catalytic domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 700-741
Classification Level Classification E-value
Superfamily PA domain 0.0000000484
Family PA domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002812   Gene: ENSGGOG00000002852   Transcript: ENSGGOT00000002874
Sequence length 932
Comment pep:known_by_projection chromosome:gorGor3.1:1:164291939:164357524:-1 gene:ENSGGOG00000002852 transcript:ENSGGOT00000002874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAGGRGCESPVPQRARWSLVAATAAFCLVSATSVWTAGAEPMSREEKQKLGNQVLEMF
DHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKT
KEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDELL
QMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAALS
RFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYLL
KAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQV
LKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGDP
YYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKEDI
IFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPL
YAQSIREPLKNVVDKSCPRGIIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSLI
HLKDGRVQLVQHAIQAASSIDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIVSHPFFGR
VVLTAGPAQFGLDLSKHKETRGFVASSKPYNGCSELTNPEAVMGKIALIQRGQCMFAEKA
RNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSKEGSIILDAIR
EYEEVEVLLSDKAKDRDPEMENEEQPSSENDSQNQSGEQISSSSQEVDLVDQESSEENSV
NSHPESLSLADMDNAASISPSEQTSNPTENHETTNLNGECTDLDNQPQEQSETEEDSNPN
VSWGKKVQPIDSILADWNEDIEAFEMMEKDEL
Download sequence
Identical sequences G3QK44
ENSGGOP00000002812 ENSGGOP00000002812 XP_004028092.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]