SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002815 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002815
Domain Number 1 Region: 249-518
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-80
Family Protein kinases, catalytic subunit 0.000000000135
Further Details:      
 
Domain Number 2 Region: 139-281
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-38
Family SH2 domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 81-163
Classification Level Classification E-value
Superfamily SH3-domain 1.47e-22
Family SH3-domain 0.0000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002815   Gene: ENSGGOG00000002861   Transcript: ENSGGOT00000002878
Sequence length 526
Comment pep:known_by_projection chromosome:gorGor3.1:20:29355885:29409343:1 gene:ENSGGOG00000002861 transcript:ENSGGOT00000002878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSNNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYRKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences G3QK47
ENSGGOP00000002815 ENSGGOP00000002815 ENSGGOP00000023319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]