SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002850 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002850
Domain Number 1 Region: 48-323
Classification Level Classification E-value
Superfamily L domain-like 6.8e-57
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 243-482
Classification Level Classification E-value
Superfamily L domain-like 1.43e-41
Family Ngr ectodomain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002850   Gene: ENSGGOG00000002897   Transcript: ENSGGOT00000002914
Sequence length 517
Comment pep:known_by_projection chromosome:gorGor3.1:12:69945196:70086303:1 gene:ENSGGOG00000002897 transcript:ENSGGOT00000002914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSRLGVLLSLPVLLQLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM
LQNNQLRQVPTEALQNLRSLQSLRLDANHISYVPPGCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA
FQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS
YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFST
LPSLIKLDLSSNLLSSFPVTGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQVQ
Download sequence
Identical sequences ENSGGOP00000002850 ENSGGOP00000002850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]