SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002878 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002878
Domain Number 1 Region: 43-311
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.09e-35
Family Nitrogenase iron protein-like 0.0000924
Further Details:      
 
Domain Number 2 Region: 284-390
Classification Level Classification E-value
Superfamily Signal peptide-binding domain 5.07e-33
Family Signal peptide-binding domain 0.000000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002878   Gene: ENSGGOG00000002926   Transcript: ENSGGOT00000002943
Sequence length 462
Comment pep:known_by_projection chromosome:gorGor3.1:14:16248471:16283690:1 gene:ENSGGOG00000002926 transcript:ENSGGOT00000002943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI
DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSK
YTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMD
ASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDF
EPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKM
GPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGR
IQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQM
AKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM
Download sequence
Identical sequences ENSGGOP00000002878 ENSGGOP00000002878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]